DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG31199

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:197 Identity:52/197 - (26%)
Similarity:79/197 - (40%) Gaps:42/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 WMAAL-----FEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSS 329
            |:|.:     ||...||..  |.|.|:|.|||::.|||  |...|...|...|.||     :.:.
  Fly    52 WVARIVYGKGFEGKIRDNG--CLGVLVSKRTVLAPAHC--FVQYNGVAEAFSVHLG-----VHNK 107

  Fly   330 GATLGV------------------ARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWN 376
            .|.:||                  |.:.||..|:.....:: ||:|.|.....|...:.|||:..
  Fly   108 SAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNS-LAVLTLQRDAKIYPNVMPICMPP 171

  Fly   377 ENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASN 441
            .:.|.|........|||....|    :.||....:|  :::..|:   |:......:|:|:|..:
  Fly   172 PSLLNETLVAQTFVVAGLRVFE----DFRLKTWVNT--LSRGFCQ---SKVKTLVTSSNTVCGYH 227

  Fly   442 AQ 443
            .|
  Fly   228 KQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 52/197 (26%)
Tryp_SPc 259..497 CDD:214473 52/197 (26%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 52/197 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.