DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG31219

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:288 Identity:69/288 - (23%)
Similarity:112/288 - (38%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFL--CGGTLISARTVISAAHCFRFGS 307
            |||:.  :.|..:..|.|......||||.|..........|  |.|:||:.|.|:::|||.    
  Fly    79 ICGQS--LSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV---- 137

  Fly   308 RNLPGERTIVSLGRNSLDLFSSGA-----------------TLGVARLLIHEQY----NPNVYTD 351
            ..:|.:.::.|:.....|:....|                 .:.:.::::|..:    |.|:  :
  Fly   138 NGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNI--E 200

  Fly   352 ADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIIT 416
            .|:|||:|...|.....|.|||:....|..:    .|..:||||:..:|.             .:
  Fly   201 YDIALLRLKMPVRYRTGIMPICIPKHGFFAK----SKLEIAGWGKTNEGQ-------------FS 248

  Fly   417 QWECRGNLSEENAKFIT----------SHTICASNAQASGPCSGDSGGGLML-QEQDIWMLRGVV 470
            |....|.:.|.:.....          |..|||........|.|||||.||: .:.....|.|:.
  Fly   249 QVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGIT 313

  Fly   471 SAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            :.|.:  |...:.:|.|||..:..:.|:
  Fly   314 TYGSK--NCGQIGIPGIYTRTSAFLPWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/274 (23%)
Tryp_SPc 259..497 CDD:214473 64/271 (24%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 64/275 (23%)
Tryp_SPc 90..342 CDD:238113 65/275 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.