DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG17475

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:123/278 - (44%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 AQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISA 293
            ||.|:...:.|.:..|:..:.:||      ||.:|:.|:..:..:|....|   ..:|||.:|..
  Fly    28 AQLSEDQLEWISKAEGVNFQNRVI------NGEDVQLGEAKYQISLQGMYG---GHICGGCIIDE 83

  Fly   294 RTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQ 358
            |.|::||||. :|.     ..|.:.:...:::.....|...|....||..||...|.: |:||::
  Fly    84 RHVLTAAHCV-YGY-----NPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHN-DIALIR 141

  Fly   359 LSNHVDIGDYIKPICLWNENFLLELP-----SGHKSYVAGWGEDEK-GNRNTRLAKMTDTDIITQ 417
            |::.:...:|.:|         .|||     :|.:..:.|||..|. |:....|.|...|.::..
  Fly   142 LNDTIKFNEYTQP---------AELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYS 197

  Fly   418 WECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNL 482
             .|:..::.:.:.. ..| ||.......|.|.|||||.|...    .:|.|:|:.|.    .|.|
  Fly   198 -TCQEIMNNDPSNG-PCH-ICTLTTGGQGACHGDSGGPLTHN----GVLYGLVNWGY----PCAL 251

  Fly   483 TLPVIYTDVAKHIEWLLS 500
            .:|..:.:|..::||:.|
  Fly   252 GVPDSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/246 (26%)
Tryp_SPc 259..497 CDD:214473 63/243 (26%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/253 (26%)
Tryp_SPc 50..269 CDD:238113 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.