DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG31265

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:286 Identity:76/286 - (26%)
Similarity:127/286 - (44%) Gaps:44/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SVHPSNTPAQASKF---YPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY 282
            :|.|.| |.::.:.   :|      :|..||        |..|.|.|.|..|:..:|...|| .:
  Fly    13 AVKPPN-PCESKRIVGPFP------AGQSGR--------IKGGEEAEIGFAPYQVSLQPIVG-SH 61

  Fly   283 NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPN 347
            |  |||.:::...:|:|.||.   ...:|....::: |.|.  ....||....|.:..|..|: .
  Fly    62 N--CGGAILNENWIITAGHCV---ENFIPALVNVIT-GTNK--WAEPGAIYYTAEIHKHCMYD-Q 117

  Fly   348 VYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGED-EKGNRNTRLAKMTD 411
            .|...|:||::|:.::...:..:||.|......|    |.:..:.|||.| ..|:....|.|:| 
  Fly   118 PYMHNDIALVKLTENITFNELTQPIALPTRPVQL----GEEIVLTGWGSDVAYGSSMEDLHKLT- 177

  Fly   412 TDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRM 476
            ..::...||....:..::..: .| ||..:.:..|.|.|||||.|:...|    |.|||:.|:  
  Fly   178 VGLVPLDECYETFNRTSSMGV-GH-ICTFSREGEGACHGDSGGPLVSNGQ----LVGVVNWGR-- 234

  Fly   477 TNRCNLTLPVIYTDVAKHIEWLLSSM 502
              .|.:.||.:..:|..:::|:.|.:
  Fly   235 --PCGVGLPDVQANVYYYLDWIRSKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/241 (27%)
Tryp_SPc 259..497 CDD:214473 65/238 (27%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 67/250 (27%)
Tryp_SPc 39..257 CDD:238113 66/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.