DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG9631

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:503 Identity:153/503 - (30%)
Similarity:228/503 - (45%) Gaps:75/503 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQLLGFLIAILQISYISAQNLPYIQCPMIFRYLEYDN-QFIGHLQLTLDSTNTENVVRVELSQRG 67
            |.|||.   .|.:...||.::|...|...|.|.:.|: .:||.........|:.: ..|..:..|
  Fly     6 LTLLGL---CLNLKLGSALHVPQHNCERYFSYYKEDSGAYIGVFTAPRAGVNSLS-WEVVFTAHG 66

  Fly    68 RNTPSTPGTLNFLEDEDSLRHRLTNNEPINYRIDFPTPG-VVPKLTKVTVNGKVACEAVPFGAPS 131
            ....:|.|:|....:::....::.:.|.....:.|...| .:|||.:...||:|.|:...:.|||
  Fly    67 TGEANTVGSLIPYPNKERAFEKIHSGERGEVFVRFTDFGNELPKLVRAEFNGEVLCQNEEYDAPS 131

  Fly   132 TRLSLSRTLRTSVPLAAIPPSQRTDHQWPQAPQTNYTVYEEEEEEEPVQRRRPQQRPSRPRPQQA 196
            :.::..:::.||.|:     ||::      ||:            |.|::|||           .
  Fly   132 STMTRRQSMSTSTPI-----SQKS------APR------------EIVRQRRP-----------P 162

  Fly   197 PSRPRLQPVPQLPQEPEFQTSARPSVHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGI 261
            ||.|...|.|.||       |..|.:...........|.|..||                   |.
  Fly   163 PSTPSNDPNPFLP-------SIMPRIDSDFEECGVEGFSPLQIG-------------------GD 201

  Fly   262 EVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSL-D 325
            .|.|||.||:|||:|.|| ...:.|..::||.||||:||||. :|.   ...:..|.|||:.. :
  Fly   202 LVTRGQYPWLAALYEGVG-TATYKCVVSVISKRTVITAAHCI-YGK---SASQLWVYLGRHDRNE 261

  Fly   326 LFSSGATL-GVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKS 389
            ...:||:| .|..:|....|..|...|||:.||.|::.:....||:|:|||..|..|....|...
  Fly   262 NPENGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPPNEGDTG 326

  Fly   390 YVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGG 454
            .|||||.|....: ||..|.....::.:.:|...:.... .|||..|:||.|:::.|||.||||.
  Fly   327 AVAGWGYDRSAQK-TRFPKTVSVRLVPRDQCLKEMKRAE-DFITRRTVCAGNSESHGPCFGDSGS 389

  Fly   455 GLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502
            .|::...:.|.:|||||...|....|:|:..|||.|||:||:|:..:|
  Fly   390 ALIVLRNNRWYVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWVRQNM 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649 22/96 (23%)
Tryp_SPc 257..498 CDD:238113 93/242 (38%)
Tryp_SPc 259..497 CDD:214473 93/239 (39%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649 22/101 (22%)
Tryp_SPc 198..436 CDD:238113 96/263 (37%)
Tryp_SPc 198..433 CDD:214473 95/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I9368
eggNOG 1 0.900 - - E33208_3BPFK
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.