DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG11037

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:112/241 - (46%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 AALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVA 336
            |.|:|.     :|:|||||::...|::||||| .|  .:.....||:.|.::|:  ..|....|.
  Fly    79 ALLYED-----DFVCGGTLLNENIVLTAAHCF-LG--RMKASEWIVAAGISNLN--QKGIRRHVK 133

  Fly   337 RLLIHEQYNPNVYTDADLALLQLSNHV---DIGDYIKPICLWNENFLLELPSGHKSYVAGWG-ED 397
            ..::.||:..: ..:.|:|::.|...:   :||..  .:|      .:.|..|.:..|:||| ..
  Fly   134 DFILSEQFRED-DMNMDVAVVLLKTPLKAKNIGTL--SLC------SVSLKPGVELVVSGWGMTA 189

  Fly   398 EKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQD 462
            .:|.....|.:.....||.:..||. ..:..|| ||...|||:.......|:.||||.|:.::| 
  Fly   190 PRGRGPHNLLRTVTVPIIHKKNCRA-AYQPTAK-ITDSMICAAVLGRKDACTFDSGGPLVFKKQ- 251

  Fly   463 IWMLRGVVSAG-QRMTNRCNLTLPVIYTDV-------AKHIEWLLS 500
               :.|:||.| ...:||    .|.:||||       .|.|:.||:
  Fly   252 ---VCGIVSFGIGCASNR----YPGVYTDVMYVKPFIEKSIKALLA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/237 (29%)
Tryp_SPc 259..497 CDD:214473 69/236 (29%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 67/230 (29%)
Tryp_SPc 62..283 CDD:238113 67/232 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.