DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG18223

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:227 Identity:52/227 - (22%)
Similarity:100/227 - (44%) Gaps:33/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFS-SGATLG--VARLLIHEQY 344
            |..|||.:||...::::|||.....:.:...|.:|.:...:..|.| .|.:|.  |.::.:.:::
  Fly    76 NHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKF 140

  Fly   345 NPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPS-----GHKSYVAGWGEDEKGNRNT 404
              .|:...::||:.|:..:.:.:.:..:        :.||:     |....|.|||...||....
  Fly   141 --TVFNTNNIALMMLAKKLPLDNPLVGV--------INLPTADPEPGLNYTVLGWGRIFKGGPLA 195

  Fly   405 RLAKMTDTDIITQWECRGNLSEENAKFITSHTICA---SNAQASGPCSGDSGGGLMLQEQDIWML 466
            ......|.:::.:     ::.|:.........:||   :|.....||:||:|..|:..|....::
  Fly   196 SDILHIDVELLPR-----DICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVV 255

  Fly   467 RGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            ...|..|.:       |||.|||:|..|::|:
  Fly   256 SYRVGCGSK-------TLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 51/225 (23%)
Tryp_SPc 259..497 CDD:214473 51/224 (23%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/227 (23%)
Tryp_SPc 60..280 CDD:214473 51/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.