DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG11529

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:257 Identity:70/257 - (27%)
Similarity:116/257 - (45%) Gaps:58/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QLPWMAALFEHVGRDY---NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLD--L 326
            :.|:...|   :|:..   ..||||||:..|.:::|.|| ..|..:..     |.||..|::  .
  Fly    40 KFPYQVML---IGKQLWRKRILCGGTLLDKRWILTAGHC-TMGVTHYD-----VYLGTKSVEDTE 95

  Fly   327 FSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHK--- 388
            .|.|..|...:.::||::||....: |:||::|...|.....|:|         ..|||.::   
  Fly    96 VSGGLVLRSNKFIVHERFNPETAAN-DIALVKLPQDVAFTPRIQP---------ASLPSRYRHDQ 150

  Fly   389 ----SYVA-GWGEDEKGNRNTRLAKMTDTD--------IITQWECRGNLSEENAKFITSHTICAS 440
                |.|| |||         .:.:||::|        :|:..||     .:....:||..|||.
  Fly   151 FAGMSVVASGWG---------AMVEMTNSDSMQYTELKVISNAEC-----AQEYDVVTSGVICAK 201

  Fly   441 NAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502
            ..:....|:|||||.|:|::..|  :.|:.|.|.  .:.|...:|..:|.|..:::|:.|.:
  Fly   202 GLKDETVCTGDSGGPLVLKDTQI--VVGITSFGP--ADGCETNIPGGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 68/251 (27%)
Tryp_SPc 259..497 CDD:214473 68/250 (27%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/254 (27%)
Tryp_SPc 37..255 CDD:214473 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.