DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG18180

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:265 Identity:67/265 - (25%)
Similarity:102/265 - (38%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 IHNGIEVERGQLPWMAALFEHV-GRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLG 320
            |.||.....|:.|::..||... |.:...:..||:|:...:::||||       |.|:...:..|
  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHC-------LTGDYVEIHYG 93

  Fly   321 RNSLDLFSSGATLGVARLLIHEQYNPNVYTD-------------ADLALLQLSNHVDIGDYIKPI 372
            .|   ...:||            |...|..|             .|:.|:: :.|||....|..|
  Fly    94 SN---WGWNGA------------YRQTVRRDNFISHPDWPSQGGRDIGLIR-TPHVDFNGLINKI 142

  Fly   373 CLWNENFLLELPSGHKS---------YVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEEN 428
                     .|||.::.         ...|||..:.||....| :..|..||:..||     |:.
  Fly   143 ---------PLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWL-QCVDVQIISNSEC-----EQA 192

  Fly   429 AKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAK 493
            ...:.|..:|..:|.....|.|||||.|:  ..|...|.||::..   :..|: ..|..||.|:.
  Fly   193 YGSVASTDMCTRHADGKSVCGGDSGGPLV--THDNARLVGVITFA---SVSCH-DGPSGYTRVSD 251

  Fly   494 HIEWL 498
            ::||:
  Fly   252 YLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/263 (25%)
Tryp_SPc 259..497 CDD:214473 64/260 (25%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 66/263 (25%)
Tryp_SPc 36..259 CDD:238113 67/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.