DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG8329

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:265 Identity:64/265 - (24%)
Similarity:98/265 - (36%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHC-------FRFGSR---NLP 311
            |.||.....|:.|:...|..:.|.    :.||::|....|::||||       ..:||.   |..
  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGA----VGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQ 95

  Fly   312 GERTIVSLGRNSLDLF-------SSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYI 369
            .:.|:     |..:.|       |:|..:|    ||...|         ::...|.|.|.:..:.
  Fly    96 LQHTV-----NKNNFFRHPGYPNSAGHDIG----LIRTPY---------VSFTNLINKVSLPKFS 142

  Fly   370 KPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLA---KMTDTDIITQWECRGNLSEENAKF 431
            :.    .|.|     ........|||    |..|..||   :..|..:|:..||..:...     
  Fly   143 QK----GERF-----ENWWCVACGWG----GMANGGLADWLQCMDVQVISNGECARSYGS----- 189

  Fly   432 ITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVV---SAGQRMTNRCNLTLPVIYTDVAK 493
            :.|..:|.........|.|||||.|:..:..|.:  ||:   |.|      |. :.|..||.|:.
  Fly   190 VASTDMCTRATDGKSVCGGDSGGALVTHDNPIQV--GVITFASIG------CK-SGPSGYTRVSD 245

  Fly   494 HIEWL 498
            |::|:
  Fly   246 HLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 63/263 (24%)
Tryp_SPc 259..497 CDD:214473 62/260 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 64/265 (24%)
Tryp_SPc 35..250 CDD:214473 63/263 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.