DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG33460

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:257 Identity:62/257 - (24%)
Similarity:90/257 - (35%) Gaps:78/257 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFR----------FGSRNLPGERTIVSLGRNS 323
            ||.|.|  |.  |.:..|.||||:...:::||.|.|          ||  ..|.|     |..:.
  Fly    44 PWTALL--HT--DGSIFCAGTLITDVFILTAASCIRPNAVKVRLGEFG--RYPNE-----LPEDH 97

  Fly   324 LDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICL----WNENFLLELP 384
            |          |...|::..:| |.....::.||:|:..|.|.|||.|:|:    .|:..     
  Fly    98 L----------VHYFLMYRLFN-NESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQL----- 146

  Fly   385 SGHKSYVAGWGEDEKGNRNTRLAK-------------MTDTDIITQWECRGNLSEENAKFITSHT 436
            |..:.....|.||.    |..|.|             .|:.|:.||:                  
  Fly   147 STMRFIGNAWMEDS----NVSLTKELRPIVIQSKPKMCTNLDLYTQF------------------ 189

  Fly   437 ICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
             ||.:......|.|.:|..|:...:.:...|. :..|....|..:......||||.|...|:
  Fly   190 -CAGHQGNLRSCDGLTGSALIQNSRYMNKYRH-IQFGIATVNDMDCEESQGYTDVLKFYWWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 61/255 (24%)
Tryp_SPc 259..497 CDD:214473 61/254 (24%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 62/257 (24%)
Tryp_SPc 44..249 CDD:214473 61/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.