DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and sphinx2

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:122 Identity:29/122 - (23%)
Similarity:52/122 - (42%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 GHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITS---HTICASNAQASGP 447
            |:.:.|.|||.|::..|.....:..:.:::...||        ||:.|.   :.:|.|.....|.
  Fly   142 GNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTEC--------AKYHTPLKWYEMCTSGEGFKGV 198

  Fly   448 CSGDSGGGLMLQEQD------IWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            |.||.||.::....:      ||:          |...|::..|.::..|:.||:|:
  Fly   199 CEGDMGGAVVTMGPNPTFIGIIWL----------MPTNCSIGYPSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 28/120 (23%)
Tryp_SPc 259..497 CDD:214473 28/119 (24%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 28/120 (23%)
Tryp_SPc 26..248 CDD:304450 29/122 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.