DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG10469

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:132/283 - (46%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 QASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAAL---FEHVGRDYNFLCGGTLI 291
            |.|..:.|..|.|.             |.||...:..|||:...|   ||. .:|...:||||::
  Fly    10 QFSLVFGQETGSLR-------------IMNGTAAKAKQLPYQVGLLCYFEG-SKDEPNMCGGTIL 60

  Fly   292 SARTVISAAHCFRFGSRNLPGERTIVSLGR-NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLA 355
            |.|.:|:||||.:....||  .:.::.:|: .|.|  .....:..:..::|::::....|: |:|
  Fly    61 SNRWIITAAHCLQDPKSNL--WKVLIHVGKVKSFD--DKEIVVNRSYTIVHKKFDRKTVTN-DIA 120

  Fly   356 LLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY------VAGWGEDEKGNRNTRLAKMTDTDI 414
            |::|...:....||:|         .:|||..|:|      ::|||...| ...:::.:.....|
  Fly   121 LIKLPKKLTFNKYIQP---------AKLPSAKKTYTGRKAIISGWGLTTK-QLPSQVLQYIRAPI 175

  Fly   415 ITQWEC----RGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQR 475
            |:..||    ...|..::.|.:.:..||..:.:.. ||.|||||.::|.:....:: |:||.|  
  Fly   176 ISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSRTLV-GIVSHG-- 236

  Fly   476 MTNRCNLTLPVIYTDVAKHIEWL 498
            ....|.|.||.:.|.|:.:::|:
  Fly   237 FDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 70/254 (28%)
Tryp_SPc 259..497 CDD:214473 69/251 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/268 (26%)
Tryp_SPc 24..260 CDD:238113 71/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.