DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG6592

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:104/237 - (43%) Gaps:50/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 FLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLL-------IH 341
            :.|||:|||.:.||:||||...      .:|.:|.||.|.:   .:....|..||:       |:
  Fly   149 YWCGGSLISDKHVITAAHCVDM------AKRALVFLGANEI---KNAKEKGQVRLMVPSENFQIY 204

  Fly   342 EQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGED 397
            ..:||....| |:|:::|.:.|...:.|.||         :||..|..|         .:|||..
  Fly   205 PTWNPKRLKD-DIAIVRLPHAVSFNERIHPI---------QLPKRHYEYRSFKNKLAIASGWGRY 259

  Fly   398 EKG-NRNTRLAKMTDTDIITQWECRGNLSEENAKFITSH---TICASNAQASGPCSGDSGGGLML 458
            ..| :..:.:.:.....||....|:.|       |..|:   .||.|...|...|:|||||.|:|
  Fly   260 ATGVHAISNVLRYVQLQIIDGRTCKSN-------FPLSYRGTNICTSGRNARSTCNGDSGGPLVL 317

  Fly   459 QEQDI--WMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            |.:..  .:|.|:.|.|.  ...|:...|..:|.||.:::|:
  Fly   318 QRRHSKKRVLVGITSFGS--IYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 67/235 (29%)
Tryp_SPc 259..497 CDD:214473 67/234 (29%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 67/235 (29%)
Tryp_SPc 123..359 CDD:238113 68/237 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.