DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG15873

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:107/256 - (41%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 VERGQLPWMAALFEHV----------GRDYNFLCGGTLISARTVISAAHCF--RF-GSRNLPGER 314
            :..|..|....|..||          .|..|..|.|.|:|:|.|::||||.  |: .|.|..|.|
  Fly    36 ISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIR 100

  Fly   315 TIVSLGR-NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDY-IKPICLWNE 377
            .:  .|. ..|.::.......|.||::|.:|..  |...|||:|:||..|...:: :.|:.:   
  Fly   101 VV--FGHITRLAVYDESDFRSVDRLVVHPEYER--YKKNDLAILRLSERVQSSNHDVLPLLM--- 158

  Fly   378 NFLLELPSGHKSYVAGWGE-DEKGNRNTRLAKMTDTDIITQWECRGNLSEEN-AKFITSHTICAS 440
            .....:..|......|||: .:.|..:..|..:   |:|.:   ..:|.::: ..|...|.:|..
  Fly   159 RKTANVTYGDTCITLGWGQIYQHGPYSNELVYL---DVILR---PPSLCQKHYDTFTADHNVCTE 217

  Fly   441 NAQASGPCSGDSGGGLMLQEQDIWMLRGVV--SAGQRMTNRCNLTLPVIYTDVAKHIEWLL 499
            ....|..|:||.||.|:.:.....::.|.:  :.|:.|.     .|..:|     :.:|:|
  Fly   218 PVGESMNCAGDMGGPLLCKGALFGLIGGHMGCAGGKAMK-----FLSFLY-----YKDWIL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 62/253 (25%)
Tryp_SPc 259..497 CDD:214473 62/252 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 58/226 (26%)
Tryp_SPc 59..250 CDD:238113 53/203 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.