DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG13527

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:117/284 - (41%) Gaps:65/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY---NFLCGGTLISARTVISAAHCF 303
            ||| ..|.|.:.:|..|....:|..:  ::.::.......|   |..|||.|:|.:.||:||||.
  Fly    18 LSG-AHRMKRLSSPKFHGDETLELAK--YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCV 79

  Fly   304 RFGSRNLPGERTIVSLGRNSLDL-FSSGATL--GVARLLIHEQYNPNVYTDADLALLQL-----S 360
            ...|:.:...|.::.:..:...| ::.|.::  .|:.|.:.:.:  .::...::||::|     |
  Fly    80 MGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF--TMHNTFNMALMKLQEKMPS 142

  Fly   361 NHVDIGDYIKPICLWNENFLLELPS-----GHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWEC 420
            |...||             .|.||.     |.:..|.|||....|  ......:...|::..   
  Fly   143 NDPRIG-------------FLHLPKEAPKIGIRHTVLGWGRMYFG--GPLAVHIYQVDVVLM--- 189

  Fly   421 RGNLSEENA--KFITSH----TICASNAQ---ASGPCSGDSGGGLMLQEQDIWMLRGVVS--AGQ 474
                  :||  |....|    .:||.|..   .:.|||||.|..|:..:    ::.|:|:  .|.
  Fly   190 ------DNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGK----VVVGIVAYPIGC 244

  Fly   475 RMTNRCNLTLPVIYTDVAKHIEWL 498
            ..||     :|.:||||...:.|:
  Fly   245 GCTN-----IPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 62/267 (23%)
Tryp_SPc 259..497 CDD:214473 61/264 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/256 (24%)
Tryp_SPc 43..263 CDD:214473 60/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.