DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and Prss48

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:271 Identity:85/271 - (31%)
Similarity:131/271 - (48%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSGICGREKVIQTPFIHNGIEVERGQLPWMAAL-FEHVGRDYNFLCGGTLISARTVISAAHCFRF 305
            |..:|||.  :.|..|..|.:...|:.||..:| |     ||...|||:|||...|::||||.: 
Mouse    27 LQSVCGRP--VHTGRIVGGQDAALGRWPWQVSLRF-----DYTHSCGGSLISDHWVLTAAHCIK- 83

  Fly   306 GSRNLPGERTIVS------LGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVD 364
                    :|..|      ||....:..|:|....|:|:.|.:::.   :|:||:|||:||:.|.
Mouse    84 --------KTWYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHR---HTEADIALLKLSSRVT 137

  Fly   365 IGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECR------GN 423
            ....|.||||.|.:..|.:|:  ..:|.|||::::|:..:.|.:: :..:|:...|.      |.
Mouse   138 FSSVILPICLPNISKQLTVPA--SCWVTGWGQNQEGHYPSTLQEL-EVPVISSEACEQLYNPIGV 199

  Fly   424 LSEENAKFITSHTICASNAQA-SGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVI 487
            ...:..:.|.....||...|: ...|.|||||.|......:|.|.||||.|.    .|...||.:
Mouse   200 FLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGL----ECGKDLPGV 260

  Fly   488 YTDVAKHIEWL 498
            ||:|..:.:|:
Mouse   261 YTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 79/254 (31%)
Tryp_SPc 259..497 CDD:214473 78/251 (31%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 79/255 (31%)
Tryp_SPc 40..274 CDD:238113 80/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.