DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and Jon44E

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:128/279 - (45%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PAQASKFYP-QTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYN---FLCGG 288
            |:::::..| :.:.:...|.||        |.||.....|::|::      ||..:|   :.|||
  Fly    19 PSESARAVPVKDMPRAGKIEGR--------ITNGYPAYEGKIPYI------VGLSFNDGGYWCGG 69

  Fly   289 TLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGA--TLGVAR--LLIHEQYNPNVY 349
            ::|....|::||||  ..|.|    ..::..|.:    |...|  |..|:|  ::.|..:|.  :
  Fly    70 SIIDHTWVLTAAHC--TNSAN----HVLIYFGAS----FRHEAQYTHWVSRSDMIQHPDWND--F 122

  Fly   350 TDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDI 414
            .:.|:||:::. |||....:..:.|.:.|......||..:..:|||..:..:..:......|..|
  Fly   123 LNNDIALIRIP-HVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQI 186

  Fly   415 ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNR 479
            |...:||   :...:.:||.:|||.:.......|||||||.|:|.:.:  .:.|:||.|.  ...
  Fly   187 IDNNDCR---NYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGS--GEG 244

  Fly   480 CNLTLPVIYTDVAKHIEWL 498
            |....|..:|.|..:::|:
  Fly   245 CTAGRPAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 67/247 (27%)
Tryp_SPc 259..497 CDD:214473 66/244 (27%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 68/256 (27%)
Tryp_SPc 41..266 CDD:238113 68/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.