DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG17572

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:126/277 - (45%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ICGREKVIQTPFIHNGIEVERGQLPWMAAL-FEHVGRD-YNFLCGGTLISARTVISAAHC----- 302
            :||: .::|..| :.|:    |..|::|.: |:||... :.:.|.|.:|:.|.:::||||     
  Fly   123 VCGK-SLVQGHF-YKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKA 181

  Fly   303 -------FRFGSRNLPGERTIVSLGRNSLDLFSSGATL--GVARLLIHEQYNPNVYTDADLALLQ 358
                   .|.|..:...:....:.|      |.:..::  .::.:::|..|....| ..|:|||.
  Fly   182 DGHRLSSVRVGEYDTSSDPDCANTG------FCAPRSVNHAISHVIVHPDYKQGQY-HHDIALLV 239

  Fly   359 LSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDI-ITQWE-CR 421
            |...::.....:||||  :.....|..|.::.:||||  :....:.|..:|:..|: :|.|: |.
  Fly   240 LKTPLNYSVATQPICL--QKTRANLVVGKRATIAGWG--KMSTSSVRQPEMSHLDVPLTSWDLCL 300

  Fly   422 GNLSE----ENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRC-N 481
            .|...    |:...|....:|| ..:....|.|..|..|.:||..|:...|::|.|   ::.| .
  Fly   301 RNYGSTGALESPNSIEGQWMCA-GGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFG---SDNCGG 361

  Fly   482 LTLPVIYTDVAKHIEWL 498
            |.:|.:||.||...||:
  Fly   362 LRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/263 (25%)
Tryp_SPc 259..497 CDD:214473 65/260 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 66/256 (26%)
Tryp_SPc 138..378 CDD:214473 65/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.