DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:298 Identity:77/298 - (25%)
Similarity:114/298 - (38%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAAL-FEHVGRDYNFL 285
            |||.:.|....            |.||        |.||.....|:.|:...| |...|   .:.
  Fly    22 VHPKDLPKDTK------------INGR--------IVNGYPAYEGKAPYTVGLGFSGNG---GWW 63

  Fly   286 CGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIH--------E 342
            |||::|:...|::||||               :.|.:.:.:: .|||........|        :
  Fly    64 CGGSIIAHDWVLTAAHC---------------TNGASQVTIY-YGATWRTNAQFTHTVGSGDFIQ 112

  Fly   343 QYN-PNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGED 397
            .:| || ....|:||:: :.|||         .|:....:||||.:..|         ..|||..
  Fly   113 NHNWPN-QNGNDIALIR-TPHVD---------FWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT 166

  Fly   398 EKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQD 462
            ..|::...: :..|..||:..||......:     ....:|.|.:.....|||||||.|:|  .|
  Fly   167 TAGSQPDWM-ECVDLQIISNSECSRTYGTQ-----PDGILCVSTSGGKSTCSGDSGGPLVL--HD 223

  Fly   463 IWMLRGVVS--AGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            ...|.||.|  :|    |.|...||..:|.|...::|:
  Fly   224 GGRLVGVTSWVSG----NGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/261 (26%)
Tryp_SPc 259..497 CDD:214473 68/258 (26%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 70/270 (26%)
Tryp_SPc 37..260 CDD:238113 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.