DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and psh

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:331 Identity:92/331 - (27%)
Similarity:149/331 - (45%) Gaps:56/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PQEPEFQTSARPSVHPSNTPAQASKFYPQTIGQL------SG------IC-----------GREK 250
            |.:|....|...||..|:|.:..:   |.|.|::      ||      .|           |.:.
  Fly    79 PTKPCCDNSTITSVSTSSTTSTKA---PMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQL 140

  Fly   251 VIQTPFIHNGIEVERGQLPWMAAL-FEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGER 314
            ||.   |..|..|:.|..|.|||: :...|.|  |.|||:||::|.|::||||....: |.|   
  Fly   141 VIH---IVGGYPVDPGVYPHMAAIGYITFGTD--FRCGGSLIASRFVLTAAHCVNTDA-NTP--- 196

  Fly   315 TIVSLGR-NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNEN 378
            ..|.||. |..:...|...:.:..:.||.||..|.|.  |:|:|:|...|...|.|:|.||..: 
  Fly   197 AFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKYN--DIAILELERDVVETDNIRPACLHTD- 258

  Fly   379 FLLELPSGHKSYVAGWGEDEKGNR-NTRLAKMTDTDIITQWECRGNLSEENAKF------ITSHT 436
             ..:.||..|.:|||||......| .:::......:::...:|..:.:|:....      :....
  Fly   259 -ATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSL 322

  Fly   437 ICASNAQ-ASGPCSGDSGGGLMLQ---EQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEW 497
            :||.:.: .:..|.|||||.|:.:   |..::.:.||:|:|    ..|....|.:||.|:.::::
  Fly   323 LCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSG----FGCATVTPGLYTRVSSYLDF 383

  Fly   498 LLSSMW 503
            :...:|
  Fly   384 IEGIVW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 75/253 (30%)
Tryp_SPc 259..497 CDD:214473 74/250 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829 92/331 (28%)
Tryp_SPc 143..384 CDD:214473 75/257 (29%)
Tryp_SPc 144..387 CDD:238113 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.