DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG31220

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:306 Identity:84/306 - (27%)
Similarity:120/306 - (39%) Gaps:68/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFE------HVGRDYNFLC 286
            ||.....||.        ||:.:.  |..:..|.|....:.||:|.|..      :..|:....|
  Fly    85 PANTLPSYPD--------CGKPQT--TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSC 139

  Fly   287 GGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSL---------DLFSSGA---------TL 333
            ||:||:.|.|::||||.         ..|::.:.|..|         |..|.||         .:
  Fly   140 GGSLINTRYVLTAAHCV---------TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDI 195

  Fly   334 GVARLLIHEQYNPNVYT-DADLALLQLSNHVDIGDYIKPICLWNENFLLELPSG---HKSYVAGW 394
            .|..:..|..|:|..|| ..|:||::|...|.......|||      :|:.|..   .|.|||||
  Fly   196 DVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPIC------VLDYPRSLMKFKMYVAGW 254

  Fly   395 GEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENA--KFITSHTICASNAQASGPCSGDSGGGLM 457
            |:....:..:::.|.....:....||    ||:.|  .|.....|||......|.|.||||..||
  Fly   255 GKTGMFDTGSKVLKHAAVKVRKPEEC----SEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLM 315

  Fly   458 ----LQEQDIWMLRGVVSAGQRMTNRC-NLTLPVIYTDVAKHIEWL 498
                ...:.|..|.|:.|.|    ..| .:..|.::|..||..:|:
  Fly   316 GTSGRSYETITFLAGITSYG----GPCGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 76/275 (28%)
Tryp_SPc 259..497 CDD:214473 76/272 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 76/276 (28%)
Tryp_SPc 104..360 CDD:238113 77/277 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.