DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG31269

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:108/260 - (41%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGR 321
            |..|...|.|..|:..:|   .|......|||.:|:...|::||||..  :..:|.  .:|..|.
  Fly    38 IIGGQAAEDGFAPYQISL---QGISGAHSCGGAIINETFVLTAAHCVE--NAFIPW--LVVVTGT 95

  Fly   322 NSLDLFSSGATLGVARLLIHEQY-NPNVYTDADLALLQLSNHVDIGDYIKPICLWNENF------ 379
            |..:  ..|....:..:.||..| ||.::.  |:|||:|         ::||. |:|..      
  Fly    96 NKYN--QPGGRYFLKAIHIHCNYDNPEMHN--DIALLEL---------VEPIA-WDERTQPIPLP 146

  Fly   380 LLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDI-------ITQWECRGNLSEENAKFITSHTI 437
            |:.:..|.:..:.|||       :|.|...:..|:       :...||:..||.:....: .| |
  Fly   147 LVPMQPGDEVILTGWG-------STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV-GH-I 202

  Fly   438 CASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502
            |..:....|.|.|||||.|:..    ..|.|:|:.|.    .|...:|.::..|..:.:|:.:.|
  Fly   203 CTFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGW----PCATGVPDVHASVYFYRDWIRNVM 259

  Fly   503  502
              Fly   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 65/254 (26%)
Tryp_SPc 259..497 CDD:214473 64/251 (25%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/254 (26%)
Tryp_SPc 38..258 CDD:238113 66/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.