Sequence 1: | NP_650343.1 | Gene: | CG9649 / 41727 | FlyBaseID: | FBgn0038211 | Length: | 504 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729255.2 | Gene: | sphinx1 / 318005 | FlyBaseID: | FBgn0052383 | Length: | 253 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 50/257 - (19%) |
---|---|---|---|
Similarity: | 91/257 - (35%) | Gaps: | 80/257 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 285 LCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVY 349
Fly 350 TDADLALLQLSNHVDIGDYIKPICLWNENF-----------LLELP------------------- 384
Fly 385 ----SGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITS---HTICASNA 442
Fly 443 QASGPCSGDSGGGLMLQEQD------IWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9649 | NP_650343.1 | GD_N | 29..124 | CDD:292649 | |
Tryp_SPc | 257..498 | CDD:238113 | 49/255 (19%) | ||
Tryp_SPc | 259..497 | CDD:214473 | 49/254 (19%) | ||
sphinx1 | NP_729255.2 | Tryp_SPc | 25..245 | CDD:214473 | 49/255 (19%) |
Tryp_SPc | 26..248 | CDD:304450 | 50/257 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471099 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |