DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and spirit

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:400 Identity:102/400 - (25%)
Similarity:174/400 - (43%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TRLSLSRTLRTSVPLAAIPPSQRTDHQWPQ-APQTNYTVY-----EEEEEEEPVQRRRPQQRPSR 190
            ||:.| ..|..|:||.|:       |..|. :||:...:.     .:|.:.|.|.|.:...|   
  Fly    11 TRVYL-HLLLVSLPLLAV-------HATPAISPQSLRGIIFPVETFDECQLEDVARTKGTCR--- 64

  Fly   191 PRPQQAPSRPRLQPVPQLPQEP--------EFQTSARPSVHPSNTPAQASKFYPQTIGQLSGICG 247
             |.:..||  .|....:..:.|        :......|:|.|..|.:.     .|...:|:.: .
  Fly    65 -RMEDCPS--ALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSS-----QQACNELNKV-S 120

  Fly   248 REKVIQTPFIH--NGIEVERGQLPWMAAL-----FEHVGRDYNFLCGGTLISARTVISAAHCFRF 305
            :.|.|...|:.  .|:.....:.|:||||     |:.  |.| :.|||.||:...|::||||...
  Fly   121 KVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQ--RIY-YRCGGALIANNFVLTAAHCADL 182

  Fly   306 GSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIK 370
            |... |.:   |.||.::|.| :.|..:.:.|::||..|:.:...: |:|||:|.....  ..:|
  Fly   183 GGEP-PSQ---VRLGGDNLTL-TEGEDISIRRVIIHPDYSASTAYN-DIALLELETAAK--PELK 239

  Fly   371 PICLWNE----NFLLELPSGHKSYVAGWGEDE-KGNRNTRLAKMTDTDIITQWECRGNLSEEN-A 429
            |.|:|.:    |.|:.        ..|:|:.. .|..:.:|.|:....:..: ||:.:..::. |
  Fly   240 PTCIWTQKEVTNTLVT--------AIGYGQTSFAGLSSAQLLKVPLKSVSNE-ECQHHYQKDQLA 295

  Fly   430 KFITSHTICASNAQAS-GPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAK 493
            :.:....:||.:.... ..|.|||||.|::|:..:..:.|:.|.||    .|....|.:||.|:.
  Fly   296 QGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQ----GCASGPPSVYTRVSS 356

  Fly   494 HIEWLLSSMW 503
            .::|:...:|
  Fly   357 FVDWIEGIVW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/254 (27%)
Tryp_SPc 259..497 CDD:214473 69/249 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/52 (17%)
Tryp_SPc 132..364 CDD:238113 70/255 (27%)
Tryp_SPc 132..361 CDD:214473 69/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.