DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG18636

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:126/292 - (43%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSGICGREKVIQTPF-IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCF-- 303
            |...||.....:|.: |.||...:....|||  :|.|...|. |:|||:||:.:.|::|||||  
  Fly    29 LDPACGIRTQSRTAYRIINGHTAKYNSSPWM--VFLHSTTDM-FVCGGSLITDKLVLTAAHCFIA 90

  Fly   304 ------RFG------SRNLPG------ERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYT 350
                  |.|      |....|      |..:|..|                  ..|:.|:||.:.
  Fly    91 NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG------------------FKHKLYDPNTHA 137

  Fly   351 DADLALLQLSNHVDIGDYIKPIC-LWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDI 414
            : |:|:|:||..|...|.|:||| :|:..:...|.........|||:.:         ..:|:|.
  Fly   138 N-DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQ---------MESDSDA 192

  Fly   415 ITQWECRGNLSEENAKF----ITSHTICASNAQASGPCSGDSGG--GLMLQEQDI--WMLRGVVS 471
            :...:.|....:..|||    |..:..||.|.. |..|:|||||  |.::..::.  ::..|:.|
  Fly   193 LQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIAS 256

  Fly   472 AGQRMTNRCNLTLPVIYTDVAKHIEWLLSSMW 503
                .||| |.....::|||..|.|::| .:|
  Fly   257 ----YTNR-NCQKASVFTDVLSHAEFIL-RVW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 77/269 (29%)
Tryp_SPc 259..497 CDD:214473 75/266 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/270 (29%)
Tryp_SPc 45..278 CDD:238113 77/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.