DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG30323

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:265 Identity:53/265 - (20%)
Similarity:91/265 - (34%) Gaps:78/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 NFLCGGTLISARTVISAAHCFRFGSRNLPGERT------IVSLGRNSLDLFSSGATLGVARLLIH 341
            |..|.|:|:||..|:::..|......:.|.:.:      :|......|...|......|.::::.
  Fly    51 NHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLD 115

  Fly   342 EQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSG-----------------HKS 389
            |.   .:....:||||:|...|.           .:.|.:.||..                 :.|
  Fly   116 ES---AISGCTELALLKLDRGVT-----------GQRFAMMLPEKELNSTWLCNSLGWGRIYYVS 166

  Fly   390 YV----------------AGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTIC 438
            ||                ..|.:|  |..::.|.::. ...|:::||:.:         .|..:|
  Fly   167 YVYISAMCPAFSMVYDNPVTWFQD--GPYSSELIQIR-AQKISEYECKPD---------CSRCLC 219

  Fly   439 ASNAQASG-PCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDV---AKHIEWLL 499
            .::....| .|..|.|..|....    .|.||.    |..:.|:....:.||::   .|.||..|
  Fly   220 MTSYTGRGNMCQQDLGSPLFCDH----FLYGVA----RRVHTCDDEGFMFYTNIYQNRKFIEDTL 276

  Fly   500 S-SMW 503
            | :.|
  Fly   277 SGATW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 50/257 (19%)
Tryp_SPc 259..497 CDD:214473 49/256 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 50/257 (19%)
Tryp_SPc 45..272 CDD:214473 48/254 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.