DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG30286

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:249 Identity:67/249 - (26%)
Similarity:110/249 - (44%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLP---GE-RTIVSLGRNSLDLFSS 329
            ||||    ::.:....:|||||::.|.:::||||.| ...||.   || .::.|:..|..|....
  Fly    47 PWMA----YLHKSGELVCGGTLVNHRFILTAAHCIR-EDENLTVRLGEFNSLTSIDCNGSDCLPP 106

  Fly   330 GATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICL-WNENFLLELPSGHKSYVAG 393
            .....:.....|..|: ......|:.||:|:..|:...:|||||| .|.....::...|:....|
  Fly   107 SEDFEIDVAFRHGGYS-RTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATG 170

  Fly   394 WGEDEKGNRNTRLAKMTDTDI------ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDS 452
            ||.......|..|..:..|.:      .|.|..|           ....||.|: ::...|||||
  Fly   171 WGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDR-----------RRDQICVSH-ESGVSCSGDS 223

  Fly   453 GG----GLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSM 502
            ||    .:.|..:.:::..|:||.|     ......|.::|:|.:||:|:::::
  Fly   224 GGPMGQAIRLDGRVLFVQVGIVSYG-----NAECLSPSVFTNVMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/243 (27%)
Tryp_SPc 259..497 CDD:214473 66/242 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 67/244 (27%)
Tryp_SPc 39..268 CDD:214473 66/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.