DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG30090

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:113/271 - (41%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRN 309
            |.||:.:|.:.             ||||.:...|    ..:||||||:.|.|::||||...||  
  Fly    41 IGGRDAIINSN-------------PWMAYIHSSV----KLICGGTLITQRFVLTAAHCVNEGS-- 86

  Fly   310 LPGERTIVSLGR---------NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDI 365
                ...|.||.         ||...........|.....|.::: .:....|:|||:|:..|..
  Fly    87 ----AVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFS-EIKNLNDIALLRLAKFVTF 146

  Fly   366 GDYIKPICLWNENFLLELPSGHKSYVA-GWGEDEKGNRNTRLAKMTDTDIITQWECR---GNLSE 426
            ..:|.|||:.......||....:.:|| |||| .:.:|...:.::|........:|.   |.|.:
  Fly   147 KAHISPICIILGTSKRELVDSIEWFVATGWGE-TRTHRTRGVLQITQLQRYNSSQCMQALGRLVQ 210

  Fly   427 ENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLR----GVVSAGQRMTNRCNLTLPVI 487
            :|       .|||... .|..|:|||||.|....:.:..:|    ||||.|.|..:...     :
  Fly   211 QN-------QICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG-----V 262

  Fly   488 YTDVAKHIEWL 498
            ||||..:.:|:
  Fly   263 YTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/257 (28%)
Tryp_SPc 259..497 CDD:214473 72/254 (28%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 76/269 (28%)
Tryp_SPc 40..276 CDD:238113 77/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.