DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG30082

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:121/285 - (42%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 TPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLI 291
            ||...::|.....|....:....:::      .|...:.|..||:|    ::.::.:.:|.||||
  Fly    16 TPKLRAQFIDPNCGTTINLPPTNRIV------GGRTADIGSNPWLA----YLHKNSSLVCTGTLI 70

  Fly   292 SARTVISAAHC---FRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDAD 353
            :.|.|::||||   |...:..|....|...:...|.....:.....|....||..:.....:..|
  Fly    71 TKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRND 135

  Fly   354 LALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQW 418
            :.||:|:..|....:|:||||:.:..  ::|.......||||:.:..|..|.| :..:...:.|.
  Fly   136 IGLLKLNGTVVYKLFIRPICLFRDPG--QVPYSSTYEAAGWGKIDLINTATVL-QTVNLIRLDQS 197

  Fly   419 ECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLR----GVVSAGQRMTNR 479
            :|..:|...    ::....||...:|. .|||||||.|..:..:..:.|    |:||.|..:...
  Fly   198 DCERSLRTS----LSYGQFCAGQWRAD-TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG 257

  Fly   480 CNLTLPVIYTDVAKHIEWLLS-SMW 503
                 |.:||.|.....|:|| :.|
  Fly   258 -----PGVYTYVPSFTNWILSITRW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/247 (26%)
Tryp_SPc 259..497 CDD:214473 64/244 (26%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 64/254 (25%)
Tryp_SPc 40..274 CDD:238113 66/256 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.