DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and F7

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:275 Identity:84/275 - (30%)
Similarity:126/275 - (45%) Gaps:36/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 CGREKVIQ-------TPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCF 303
            ||:..:::       ...|..|....:|:.||...|..:..:    |||||||:...|:||||||
Human   224 CGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQ----LCGGTLINTIWVVSAAHCF 284

  Fly   304 R--FGSRNLPGERTIVSLGRNSLDLFSSG-ATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDI 365
            .  ...|||     |..||.:.|...... .:..||:::|...|.|.. |:.|:|||:|...|.:
Human   285 DKIKNWRNL-----IAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGT-TNHDIALLRLHQPVVL 343

  Fly   366 GDYIKPICLWNENFL-LELPSGHKSYVAGWGE-DEKGNRNTRLAKMTDTDIITQWECRGNLSEEN 428
            .|::.|:||....|. ..|.....|.|:|||: .::|.....|..:....::|| :|    .:::
Human   344 TDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQ-DC----LQQS 403

  Fly   429 AKF-----ITSHTICASNAQAS-GPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVI 487
            .|.     ||.:..||..:..| ..|.|||||......:..|.|.|:||.||......:..   :
Human   404 RKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFG---V 465

  Fly   488 YTDVAKHIEWLLSSM 502
            ||.|:::||||...|
Human   466 YTRVSQYIEWLQKLM 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 79/251 (31%)
Tryp_SPc 259..497 CDD:214473 77/248 (31%)
F7XP_011535776.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.