DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and try-5

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:301 Identity:78/301 - (25%)
Similarity:123/301 - (40%) Gaps:51/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ICGREKVIQTPFIHNGIEVERGQ----LPWMAALFEHVGR-DYNFLCGGTLISARTVISAAHCFR 304
            :|||:.. .|.|:........|.    .||...:.....: |:..:||||||:.:.|::|||||:
 Worm    28 LCGRQST-YTSFMLTDAAGNTGNPTHLAPWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQ 91

  Fly   305 --FGSRNLPGE----------------------RTIVSLGR---------NSLDLFSSGATLGVA 336
              ||::...||                      ||:|::|.         ..::...:|.||.::
 Worm    92 KHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKIS 156

  Fly   337 RLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLE--LPSGHKSYVAGWGEDE- 398
            |..|.:.|..:.....|:.:|:|.:.:|..:.....||   .||.|  :.||......|||.|. 
 Worm   157 RFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACL---PFLPEVNIQSGANVTSFGWGSDPG 218

  Fly   399 KGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDI 463
            ||..|.....:....:.|  |......|.....|...:.|.:..:....|||||||||...:.|.
 Worm   219 KGFDNAAFPMIQVLTLAT--ETLATCEENWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDS 281

  Fly   464 --WMLRGVVSAGQRMTNRCNLTLP--VIYTDVAKHIEWLLS 500
              ..:..:||.|.........:.|  .|.|||.||.:::::
 Worm   282 AREFIIAIVSYGSDCVQLIGGSEPRSQINTDVRKHQKFIVN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 73/285 (26%)
Tryp_SPc 259..497 CDD:214473 73/282 (26%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_124240
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.