DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and try-6

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:280 Identity:59/280 - (21%)
Similarity:102/280 - (36%) Gaps:80/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 CGREKVIQTPFIHNGIEVERGQLPWMAAL-----FEHVGRDYNFLCGGTLISARTVISAAHCFRF 305
            ||:....:   |.||.:.|..:.||...:     .:::...::..|.|||.|.|.:::|.||...
 Worm    33 CGKNVKSK---IFNGRKAEIDEAPWAVRINTYTNVKNIDETWSKHCSGTLTSPRHILTATHCAAT 94

  Fly   306 GS--------------------------RNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQY 344
            .:                          |.:...|.:|.| ||..:       :|.|:.|....|
 Worm    95 YTETEWNGTVIDAPIYRKYCEEQSTLIVREVAASRIVVRL-RNRTE-------IGRAKYLFMFNY 151

  Fly   345 -----NPNVYT---DADLALLQLSNHVDIGDYIKPICL---WNENFLLELPSGHKSYVAGWGEDE 398
                 :.|.|.   ..|:.:::||..|:....:||:|:   .::|    .|:.|.. :.|:|:|.
 Worm   152 CRKIVDKNAYEIQYPDDIMIIELSEDVEYSSELKPVCVAGNTDDN----APNSHLD-LFGFGDDP 211

  Fly   399 KGNRNTRLAKMTDTDI------ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLM 457
            ..::.:.|..:.|..:      |......|.....:.:..    |..|..:.|..|.||||.|  
 Worm   212 PRDKPSSLKNLHDIPLKHHKVEIMDMNKEGTSKRMDPRLF----IAKSVTRTSVACPGDSGAG-- 270

  Fly   458 LQEQDIWMLRGVVSAGQRMT 477
                      ||....:|.|
 Worm   271 ----------GVKEIDKRTT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 57/269 (21%)
Tryp_SPc 259..497 CDD:214473 56/267 (21%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 59/280 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.