DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and try-4

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:290 Identity:71/290 - (24%)
Similarity:111/290 - (38%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FYPQTIGQLSGICGREKVIQTPFIHN--GIEVER--GQLPWMAAL-FEHVGRDYNFLCGGTLISA 293
            |.|..||....:...:.::....:..  ||:.|.  ...||..:. .:.|.|     .||::||.
 Worm    20 FEPVWIGNAFSMESFQTIVDNEVLMESCGIQQESKIKNFPWAVSFTVDGVNR-----LGGSIISP 79

  Fly   294 RTVISAAHCF--RFGSR-NL--------PGE---RTIVSLGRNSLDLFSSGATL----------- 333
            ..:|:|||.|  ..||| ||        |..   |:|..| |::..:...|..:           
 Worm    80 YHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFL-RDTRKVAYGGTCIRGHTDKYPNDP 143

  Fly   334 ----------GVARLLIHEQY-NPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGH 387
                      .|..:|:..:: :.|.....|.|::::...:...:.::||||...|....     
 Worm   144 RCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLPRPNMYYT----- 203

  Fly   388 KSY-VAGWGE----DEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGP 447
            ||. |.|||.    :|.|.....:....|.|....|..|  |..:...||.:.::..||..|...
 Worm   204 KSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDR--LPADADDFICATSMNVSNYSAPRT 266

  Fly   448 CSGDSGGGLMLQEQDIW--MLRGVVSAGQR 475
            |.|||||||..::.:..  .|..:.|.|.|
 Worm   267 CHGDSGGGLEYRDDNYGRAFLIAITSFGTR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 67/267 (25%)
Tryp_SPc 259..497 CDD:214473 67/265 (25%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 65/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.