DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG43742

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:266 Identity:77/266 - (28%)
Similarity:124/266 - (46%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 KVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGER 314
            ||..|..:.||......|  :||||:    .:..|.|||:||..:.|::||||.    |:|  :.
  Fly    28 KVKITYRVANGHTAITSQ--FMAALY----NNSEFFCGGSLIHKQYVLTAAHCV----RDL--DE 80

  Fly   315 TIVSLGRNSLDLFSSGATLGV--------ARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKP 371
            ..|.||.|     :....:.|        |::::|..::.|::.: |:|||:|...|....:|:|
  Fly    81 VTVHLGEN-----NRSCPIPVCKHVLRLNAKVILHPNFHGNIFLN-DIALLRLEREVIFEAHIRP 139

  Fly   372 IC-LWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSH 435
            || :.:|:......:...:|  |||:.|.||.:..|: ..|...:.:..|..|:          :
  Fly   140 ICIILDEDVTSNNQNNFTAY--GWGKTEHGNISDVLS-FIDLVRLPKSMCYQNI----------N 191

  Fly   436 TICASNAQASGPCSGDSGGGLM------LQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKH 494
            ||||.:. :...|..||||.|:      .:.:||  |.|:.|.|..   .|: .|..:||||..:
  Fly   192 TICAGST-SGDTCESDSGGPLIGNFVHRGKSRDI--LFGITSYGDA---ECS-GLFGVYTDVNAY 249

  Fly   495 IEWLLS 500
            ..|:.|
  Fly   250 KSWIAS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/255 (28%)
Tryp_SPc 259..497 CDD:214473 72/252 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 72/256 (28%)
Tryp_SPc 35..256 CDD:238113 74/259 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.