DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG43124

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:244 Identity:52/244 - (21%)
Similarity:88/244 - (36%) Gaps:71/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATL 333
            ||:|.:..    |...:|.|.||:...|::||.||:      ..|:..|.||....|  .|....
  Fly    41 PWLAEILS----DSKVICAGALINNLYVLTAASCFK------ENEKLTVRLGSGYFD--KSYENF 93

  Fly   334 GVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDE 398
            .|.:......:.|...|: :|.:.:|...|:...:|:|:|:                       .
  Fly    94 RVTKAYFWMTHFPANNTN-NLCIFRLQTEVEFKTHIRPMCI-----------------------T 134

  Fly   399 KGNRNTRLAKMTDTDIITQ----WE---------CRGNLSEENAKFITSHTICA-SNAQASGPCS 449
            |..::..||  |..:||.:    |.         |:....|...|:.:..|... :...::||  
  Fly   135 KSPKSLGLA--TTFEIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPTGSPWTETISNGP-- 195

  Fly   450 GDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
                            .:|:|..| .::.|.|.|...:|.:|..||.|:
  Fly   196 ----------------FKGLVRYG-ILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 51/242 (21%)
Tryp_SPc 259..497 CDD:214473 51/241 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.