DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and f7

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:275 Identity:75/275 - (27%)
Similarity:116/275 - (42%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 CGREKVIQT-----------PFIHNGIEVERGQLPWMAAL-FEHVGRDYNFLCGGTLISARTVIS 298
            ||:..::|.           ..|..|.|..:|..||...| :...|     .|||.:.....:::
Zfish   174 CGKVPLLQAGKAADHQVDLRSRIVGGSECPKGHCPWQVLLKYGEKG-----FCGGVIYKPTWILT 233

  Fly   299 AAHCF-----RFGSRNLPGERTI-VSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALL 357
            ||||.     :| .|.:.||..: |..|...|        :.|.::..|..|.... .|:|:|||
Zfish   234 AAHCLEKLKVKF-LRIVAGEHDLEVDEGTEQL--------IQVDQMFTHPAYVSET-ADSDIALL 288

  Fly   358 QLSNHVDIGDYIKPICL-WNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWEC- 420
            :|...:....|..|:|| ..|....||.:..|..|:|||:..:....:||.:......|...|| 
Zfish   289 RLRTPIVYSVYAVPVCLPLREMAERELWAVSKHTVSGWGKRSEDGPTSRLLRRLLVPRIRTQECV 353

  Fly   421 -RGNLSEENAKFITSHTICASNAQA-SGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLT 483
             ..||:      :||:..||...:. ...|.|||||.|:.:.:|...|.|:||.|:......:..
Zfish   354 QVSNLT------LTSNMFCAGYIEGRQDSCKGDSGGPLVTRYRDTAFLLGIVSWGKGCARPGSYG 412

  Fly   484 LPVIYTDVAKHIEWL 498
               |||.|:.:::|:
Zfish   413 ---IYTRVSNYLQWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 71/251 (28%)
Tryp_SPc 259..497 CDD:214473 70/248 (28%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 71/252 (28%)
Tryp_SPc 196..427 CDD:238113 72/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.