DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG42694

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:291 Identity:77/291 - (26%)
Similarity:120/291 - (41%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SKFYPQTIGQLSGICGREKVIQTPFIHNGI-EVERGQLPWMAALFEHVGRDYNFLCGGTLISART 295
            |||       |...||      .|..:..| ::.:.|..|:|    |:....:.||.|:|||.:.
  Fly    20 SKF-------LDDYCG------APISNQSITKLRQPQAGWLA----HISNGTHVLCSGSLISKQF 67

  Fly   296 VISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYT---------- 350
            |:|||.|.     ::.| :..|.||       .|.||           .:|:.||          
  Fly    68 VLSAAQCI-----DVHG-KLFVQLG-------VSNAT-----------KSPHWYTVSNVVIPSHS 108

  Fly   351 ----DADLALLQLSNHVDIGDYIKPICL-WNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMT 410
                ..|:.||:||..||..|::.|||: .|.|.|..:........:.|....|..:...|::  
  Fly   109 GKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQ-- 171

  Fly   411 DTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGL---MLQEQDI-----WMLR 467
                :::..|:.|||..    :|...|||::.|.:..|..|||..|   ::|..:|     :.:|
  Fly   172 ----LSRDRCKLNLSGN----VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIR 228

  Fly   468 GVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            |.|:      .|...:.|.||.|||:.:.|:
  Fly   229 GYVN------GRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/264 (26%)
Tryp_SPc 259..497 CDD:214473 69/261 (26%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 68/252 (27%)
Tryp_SPc 46..253 CDD:214473 67/250 (27%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.