DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and taar12j

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001076380.1 Gene:taar12j / 795139 ZFINID:ZDB-GENE-041014-59 Length:340 Species:Danio rerio


Alignment Length:322 Identity:92/322 - (28%)
Similarity:152/322 - (47%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGY 193
            |.:..|:.::|..:|.||:|:.::|...:.|:...:|.:.|||.:|..:.||||.::.|..:.|.
Zfish    35 VTMYAFMVLMILTTVFGNLLIIISISHFKQLQSPTHLIVRSLAASDCLLGSLVMPYSMVRSVEGC 99

  Fly   194 WIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAF 258
            |..|...|....:.|:..|.:|:::|..:|:|||..|.|||||...||....::.....||.:..
Zfish   100 WYLGDVVCKVHSSLDMTFSISSLIHLSLVSVDRYWAICDPLRYRMRVTNNTVIVFTVFTWLFSFV 164

  Fly   259 VSFVPISLGIHRPD-QPLIFEDNGKKY--PTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYC 320
            .||..:..|::|.. :..|.:    .|  .:|.|.....:.::.|.::|:.||.:|..:|.:::.
Zfish   165 YSFSVVFSGVNRIGLETFIMQ----VYCVGSCVLFFNKQWGLICSLLTFFLPCTIMSSLYMKIFH 225

  Fly   321 YAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMG 385
            .|:||.|.:......|                         |.:.||...  :.|||.|:.::||
Zfish   226 VARKHAKVMSERVTGG-------------------------LKSQSSAQR--EGKAAKTLAIVMG 263

  Fly   386 VFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILT 447
            ||.:||:|||.......|.........|..|.|.||.||..||:||..|...|:.||..:::
Zfish   264 VFYLCWLPFFTATAVDPFLNFSTPVHVFDALVWFGYFNSTCNPLIYGFFYPRFQKAFNILIS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 42/131 (32%)
7tm_1 145..431 CDD:278431 82/288 (28%)
taar12jNP_001076380.1 7tm_4 49..320 CDD:304433 87/301 (29%)
7tm_1 51..309 CDD:278431 82/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.