DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1875

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_002728833.2 Gene:Olr1875 / 690767 RGDID:1592197 Length:321 Species:Rattus norvegicus


Alignment Length:386 Identity:84/386 - (21%)
Similarity:147/386 - (38%) Gaps:103/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TTLTSF--YNESSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTER 157
            ||:|:|  :..||:             ||..:|:.:|::...:|:|:     .|..:.:||....
  Rat     5 TTVTTFLLWGFSSF-------------PELQNLLFVVILLSHVSILL-----ANASIMVAIKLNH 51

  Fly   158 SLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAI 222
            :|......||.:|:.::.....:::....|:.:..........|.|.:.|.......:...|.|:
  Rat    52 NLHTPMYFFLFALSFSETCTTMVILPRMLVDLISKSKAISLPECATQMFFFFGLGGNNCFILSAM 116

  Fly   223 SMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIF-----EDNGK 282
            |.|||..|.:||.|...:|:::.:..|.|..:|...||...:         ..||     ..|..
  Rat   117 SYDRYTAINNPLHYPILMTQKICLQLIIASGVLGFSVSLCIV---------VTIFNLSFCNSNII 172

  Fly   283 KYPTCALDLTPTYAVVS-SC-ISFY-------FPCVVMIGIYCRL---YCYAQKHVKSIKAVTRP 335
            ::..|.:|     .||| :| ::||       |...|::|.:..:   |.:....|..:.:.   
  Rat   173 QHFFCDID-----PVVSLACNLTFYHKVILFAFTAFVLVGSFIFIMVSYVFIVTVVMKMPSA--- 229

  Fly   336 GEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNIT 400
                 |.|||:               ..|.||.:.|          |.:.....|:| :.....:
  Rat   230 -----KGRYKT---------------FSTCSSHFTV----------VFIHYGFACFV-YLRPKNS 263

  Fly   401 AAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNI 461
            .:|....:...|:.|||.|      .||||||:.||..:.|.::            |:||:
  Rat   264 YSFKDDTLLAMTYTILTPL------LNPIIYSLRNKSMQTALRK------------DIGNV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 29/131 (22%)
7tm_1 145..431 CDD:278431 63/302 (21%)
Olr1875XP_002728833.2 7tm_4 36..301 CDD:304433 70/323 (22%)
7tm_1 40..288 CDD:278431 63/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.