DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Htr6

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_077341.2 Gene:Htr6 / 64354 RGDID:62044 Length:438 Species:Rattus norvegicus


Alignment Length:322 Identity:123/322 - (38%)
Similarity:174/322 - (54%) Gaps:21/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWI 195
            |...|.|:|.|:.|.|.|:.:.|.|:.:||...|.||.||..:||.|..:||..|.:|.|.|.|:
  Rat    29 VAAALCVVIVLTAAANSLLIVLICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWV 93

  Fly   196 FGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVS 260
            .....|..|.||||||.:|||||||.||:|||:.|..||||...:|...|:..|...|.|||..|
  Rat    94 LARGLCLLWTAFDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALAS 158

  Fly   261 FVPISLGIHRPDQPLIFEDNGK-KYPT---CALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCY 321
            |:|:.||.|         :.|| :.|.   |.|..:..:.:|:|.::|:.|...:...|||:...
  Rat   159 FLPLLLGWH---------ELGKARTPAPGQCRLLASLPFVLVASGVTFFLPSGAICFTYCRILLA 214

  Fly   322 AQKHVKSIKAVT--RPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIM 384
            |:|....:.::|  ..|:..|..:..  |.|:...:....|.|.|..|...:   ||::|:|:::
  Rat   215 ARKQAVQVASLTTGTAGQALETLQVP--RTPRPGMESADSRRLATKHSRKAL---KASLTLGILL 274

  Fly   385 GVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRIL 446
            |:|.:.|:|||..||..|.| .||....|.:||||||.||..|||||.:|.::|:.|..|.|
  Rat   275 GMFFVTWLPFFVANIAQAVC-DCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 61/131 (47%)
7tm_1 145..431 CDD:278431 110/291 (38%)
Htr6NP_077341.2 7tm_1 44..320 CDD:278431 110/290 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24247
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.