DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and adrb2a

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001096122.1 Gene:adrb2a / 565838 ZFINID:ZDB-GENE-100414-3 Length:405 Species:Danio rerio


Alignment Length:369 Identity:136/369 - (36%)
Similarity:203/369 - (55%) Gaps:47/369 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLA 171
            ||||..           |.:.:.|:|..:|:|:.:.|.||::|..||...:.|:.:.|.|:.|||
Zfish    18 TNASTK-----------SELQMTVLGTLMSILVLIIVFGNVMVITAISRFQRLQNVTNCFITSLA 71

  Fly   172 IADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRY 236
            .|||.:..:|:.|..:..:|..|.||...||.|.|.||:|.||||..||.|:|||||.|..|.||
Zfish    72 CADLVMGLVVIPFGALYIILNTWHFGHFLCDFWTATDVLCVTASIETLCVIAMDRYIAITSPFRY 136

  Fly   237 GRWVTRRVAVITIAAIWLLAAFVSFVPISL--GIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVS 299
            ...:|:..|...:..:|::|..||::||.:  .|...::.|...:|  .| .|..|:|.:||:||
Zfish   137 QSLLTKNRARFIVLMVWVIAGLVSYLPIHMEWWISTDNETLCCYNN--TY-CCEFDITYSYAIVS 198

  Fly   300 SCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH- 363
            |.||||.|.|:|:.:|.|::..|:|.:|.|...        :.|:.:   .|:..:...|.|.| 
Zfish   199 SIISFYIPLVIMVFVYSRVFQEARKQLKKINKT--------EGRFHA---QKSNSRNQDVANNHS 252

  Fly   364 ----THSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNS 424
                |..:.:::.:|||..|:|:|||||.:||:|||.:|:..   |..:...||:||.|:||:||
Zfish   253 EMRSTKKAKFYLKEHKALKTLGIIMGVFTLCWLPFFVLNVIP---KGSVDIWTFRILNWIGYANS 314

  Fly   425 AFNPIIYSIFNKEFRDAFKRILTM---RNPWCCAQDVGNIHPRN 465
            ||||:|| ..:.:||.|||.||.:   |.|        |:.|.|
Zfish   315 AFNPLIY-CGSPDFRYAFKEILCLNRSRYP--------NVRPNN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 54/131 (41%)
7tm_1 145..431 CDD:278431 112/292 (38%)
adrb2aNP_001096122.1 7tm_4 43..>235 CDD:304433 77/202 (38%)
7tm_1 45..321 CDD:278431 112/292 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.