DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1635

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000970.1 Gene:Olr1635 / 405325 RGDID:1333574 Length:328 Species:Rattus norvegicus


Alignment Length:375 Identity:80/375 - (21%)
Similarity:139/375 - (37%) Gaps:118/375 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EPLSL-----VSIVVVG--------IFLSVLIF----LSVAGNILVCLAIYTERSLRRIGNLFLA 168
            :|::|     ...|::|        |||.||..    |::.||..:..|:..:..|.......|.
  Rat    14 DPMNLSTTHVTEFVLLGFPGSWKTQIFLFVLFLLFYVLTLLGNGAIICAVRCDSRLHTPMYFLLG 78

  Fly   169 SLAIADL-FVASLV-------------MTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNL 219
            :.|..:: :|:|.|             ::|:|              |.....|.....|...|.|
  Rat    79 NFAFLEIWYVSSTVPNMLANILSKTKAISFSG--------------CFLQFYFFFSLGTTECLFL 129

  Fly   220 CAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSF-VPI-SLGIHRPDQPLIFEDNGK 282
            ..::.|||:.|..||.|...:|||:..|.:::.||: .|:.: :|| |:               .
  Rat   130 AVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLI-GFLGYPIPIFSI---------------S 178

  Fly   283 KYPTCA--------LDLTPTYAVVSSC-----ISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTR 334
            :.|.|.        .|:.|..|:  ||     ..|.|.......::..:....:.::..::||.:
  Rat   179 QLPFCGSNIIDHFLCDMDPLMAL--SCALAPITEFIFYAQSSFVLFFTISYILRSYILLLRAVFQ 241

  Fly   335 PGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWV-PFFCVN 398
            ....|.::            |.|.....|             .|.|.:..|..::.:| |.:.::
  Rat   242 VPSAAGRR------------KAFSTCGSH-------------LVVVSLFYGTVMVMYVSPTYGIS 281

  Fly   399 ITAAFCKTCIGGQTFKILTWLGYS--NSAFNPIIYSIFNKEFRDAFKRIL 446
            ....           |||| |.||  ...|||:|||:.||:.:.|.:::|
  Rat   282 TLMQ-----------KILT-LVYSVMTPLFNPLIYSLRNKDMKLALRKVL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 37/151 (25%)
7tm_1 145..431 CDD:278431 63/317 (20%)
Olr1635NP_001000970.1 7tm_4 53..320 CDD:304433 70/336 (21%)
7tm_1 55..304 CDD:278431 63/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.