DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1622

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000838.1 Gene:Olr1622 / 405127 RGDID:1334259 Length:312 Species:Rattus norvegicus


Alignment Length:368 Identity:78/368 - (21%)
Similarity:136/368 - (36%) Gaps:82/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NASEMDTIV--------GEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGN 164
            |.||..|:.        |.....::|.|:::      ::..:::.||:.:..|:...:.|.....
  Rat     2 NKSEASTVTYFVLLGFPGPWKIQITLFSLIL------LVYMITLTGNMAIICAVRWNQQLHTPMY 60

  Fly   165 LFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIH 229
            :|||:.:..:::..:..:....||.|..........|.|...|.....|.....|||::.|||:.
  Rat    61 MFLANFSFLEIWYVTCTVPNMLVNFLSKTKTMSFSGCFTQFYFFFSLGTTECFFLCAMAYDRYLA 125

  Fly   230 IKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPI----SLGIHRP---DQPLIFEDNGKKYPTC 287
            |..||.|...:||:...|.::..|::...:..:||    .|....|   |..|...|     |..
  Rat   126 ICHPLHYPAIMTRQFCSILVSLCWIIGFSLYLIPIFFISQLSFCGPNIIDHFLCDVD-----PLM 185

  Fly   288 ALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTR-PGEVAEKQRYKSIRRPK 351
            ||..|.|..|.....|.....:.:.|:|     ....::..::||.: |.:              
  Rat   186 ALSCTHTPIVKHVFYSISTLIITLTGLY-----ILASYILVLRAVLQVPSD-------------- 231

  Fly   352 NQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQT---F 413
            .:.|.|.....|             .:.|.:..|..::.:|             |...|::   .
  Rat   232 GRQKAFSTCGSH-------------LLVVSLFYGTIVVMYV-------------TPTSGKSVDMH 270

  Fly   414 KILTWLGYS--NSAFNPIIYSIFNKEFRDAFKRI----LTMRN 450
            |.:| |.||  ..|.||.|||:.||:.:.|...:    :.|:|
  Rat   271 KAIT-LIYSVVTPALNPFIYSLRNKDMKYALHNVFFGKMIMKN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 30/135 (22%)
7tm_1 145..431 CDD:278431 63/298 (21%)
Olr1622NP_001000838.1 7tm_4 33..307 CDD:304433 69/324 (21%)
7tm_1 41..289 CDD:278431 63/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.