DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1631

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000837.1 Gene:Olr1631 / 405126 RGDID:1333318 Length:324 Species:Rattus norvegicus


Alignment Length:338 Identity:74/338 - (21%)
Similarity:124/338 - (36%) Gaps:75/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVGIFLSVLIF--LSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLL 191
            :.:.:|:..|:|  |::.||..:..|:..:..|......||.:.|..:::..|........|.|.
  Rat    33 IQIFLFVLFLVFYVLTLLGNGAIICAVICDSRLHTPMYFFLGNFAFLEIWYVSSTAPNMLANILS 97

  Fly   192 GYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLA 256
            .........|.....|.....|:....|..::.|||:.|..||.|...:|||:..|.:::.||: 
  Rat    98 KTKAISFSGCFLQFYFFFSLGTSECFFLTVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLI- 161

  Fly   257 AFVSF-VPI-------SLGIHRPDQPLIFEDNGKKYPTCALDLTP------TYAVVSSCISFYFP 307
            .|:.: :|:       ..|.:..|..|...|     |..||...|      .:.|.:|...|:..
  Rat   162 GFLGYPIPVFSISQLPFCGPNTIDHFLCDMD-----PLMALSCAPAPITKLVFYVQNSFFLFFTI 221

  Fly   308 CVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVS 372
            ..::           :.::..::||                        |:|        |....
  Rat   222 TYIL-----------RSYILLLRAV------------------------FQV--------PSAAG 243

  Fly   373 DHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTF--KILTWLGYS--NSAFNPIIYSI 433
            ..||..|.|..:.|     |..|...:...:.....|..|.  |||| |.||  ...|||:|||:
  Rat   244 RRKAFSTCGSHLAV-----VSLFYGTVMIMYMSPTYGISTLMQKILT-LVYSVMTPLFNPLIYSL 302

  Fly   434 FNKEFRDAFKRIL 446
            .|.:.:.|.:::|
  Rat   303 RNSDMKLALRKVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 33/141 (23%)
7tm_1 145..431 CDD:278431 64/303 (21%)
Olr1631NP_001000837.1 7tm_4 41..316 CDD:304433 73/330 (22%)
7tm_1 51..300 CDD:278431 64/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.