DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr241

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000734.1 Gene:Olr241 / 404992 RGDID:1334165 Length:310 Species:Rattus norvegicus


Alignment Length:380 Identity:90/380 - (23%)
Similarity:147/380 - (38%) Gaps:125/380 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TNASEMDTIVG--EEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLAS 169
            |..:|: .|:|  |:|:    :.||...|||.|.| :::.|||.:...|.....|:....|||:.
  Rat     7 TTVAEL-VILGLTEDPK----LCIVFFVIFLGVYI-VTLVGNISIITLIRISSQLQTPMYLFLSH 65

  Fly   170 LAIADLFVASLVMTFAGVNDLLGYWIF------GAQFCDTWVAFDVMCSTASILNLCAISMDRYI 228
            ||..|:..::.|.... :.:|||:.:.      .||.|.| |:|    .:|....|.|::.|||:
  Rat    66 LAFVDILYSTSVSVIM-LMELLGHGLVLPVTACAAQLCIT-VSF----GSAECFLLAAMAYDRYV 124

  Fly   229 HIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTP 293
            .|..||.|...::.||..:.:.        :|:|.   |.          .||..:..|.|:|  
  Rat   125 AICSPLLYSTLMSSRVCFLLLG--------MSYVG---GC----------TNGWTFTGCLLNL-- 166

  Fly   294 TYAVVSSC----ISFYF---------PC--VVMIGIYCRLYCYAQKHVKSIKA----VTRPGEVA 339
                 |.|    |..:|         .|  |.:|||           :.||.:    |.....:|
  Rat   167 -----SFCGPNQIDHFFCDFSPLLKLSCSDVSIIGI-----------IPSISSGSIIVVTILVIA 215

  Fly   340 EKQRY-----KSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTV--GVIMGVFLICWVPFFCV 397
            ....|     ..:|..:.:.|.|..           .:.|..|||:  |.|..:::   :|    
  Rat   216 VSYIYILITILKMRSTEGRHKAFST-----------CTSHLTAVTLYYGTITFIYV---MP---- 262

  Fly   398 NITAAFCKTCIGGQTFKILTWLGYSNSAF--------NPIIYSIFNKEFRDAFKR 444
                   |:....:..|:|       |.|        ||:|||:.|::.::|.::
  Rat   263 -------KSNYSTEQNKVL-------SVFYTVVIPMLNPLIYSLRNRDVKEALRK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 39/137 (28%)
7tm_1 145..431 CDD:278431 72/325 (22%)
Olr241NP_001000734.1 7tm_4 31..304 CDD:304433 81/351 (23%)
7tm_1 41..290 CDD:278431 72/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.