DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and OR11H4

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001004479.2 Gene:OR11H4 / 390442 HGNCID:15347 Length:314 Species:Homo sapiens


Alignment Length:334 Identity:77/334 - (23%)
Similarity:127/334 - (38%) Gaps:64/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDL 190
            :.|.:..:|| |:..|::.||..:..|:.....|.......|.:.|..:::..|..:....||.|
Human    23 IQIFLFSLFL-VIYVLTLLGNGAIIYAVRCNPLLHTPMYFLLGNFAFLEIWYVSSTIPNMLVNIL 86

  Fly   191 LGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLL 255
            ..........|.....|.....|...|.|..::.|||:.|..||:|...:|.|.....::..||:
Human    87 SKTKAISFSGCFLQFYFFFSLGTTECLFLAVMAYDRYLAICHPLQYPAIMTVRFCGKLVSFCWLI 151

  Fly   256 AAFVSF-VPISLGIHRP-------DQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMI 312
             .|:.: :||......|       |..|...|     |..||...|  |.::.|| ||....:::
Human   152 -GFLGYPIPIFYISQLPFCGPNIIDHFLCDMD-----PLMALSCAP--APITECI-FYTQSSLVL 207

  Fly   313 GIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAA 377
             .:..:| ..:.::..:.||.:....|.::            |.|.....|             .
Human   208 -FFTSMY-ILRSYILLLTAVFQVPSAAGRR------------KAFSTCGSH-------------L 245

  Fly   378 VTVGVIMGVFLICWV-PFFCVNITAAFCKTCIGGQTF--KILTWLGYS--NSAFNPIIYSIFNKE 437
            |.|.:..|..::.:| |.:             |..|.  |||| |.||  ...|||:||::.||:
Human   246 VVVSLFYGTVMVMYVSPTY-------------GIPTLLQKILT-LVYSVTTPLFNPLIYTLRNKD 296

  Fly   438 FRDAFKRIL 446
            .:.|.:.:|
Human   297 MKLALRNVL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 33/132 (25%)
7tm_1 145..431 CDD:278431 66/298 (22%)
OR11H4NP_001004479.2 7tmA_OR11G-like 25..294 CDD:320579 73/319 (23%)
TM helix 1 27..51 CDD:320579 7/24 (29%)
TM helix 2 60..82 CDD:320579 3/21 (14%)
TM helix 3 98..120 CDD:320579 4/21 (19%)
TM helix 4 143..159 CDD:320579 3/16 (19%)
TM helix 5 196..219 CDD:320579 5/25 (20%)
TM helix 6 238..260 CDD:320579 5/34 (15%)
TM helix 7 269..294 CDD:320579 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.