DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and OR5T3

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001004747.2 Gene:OR5T3 / 390154 HGNCID:15297 Length:322 Species:Homo sapiens


Alignment Length:367 Identity:76/367 - (20%)
Similarity:122/367 - (33%) Gaps:135/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IFLSVLIF----LSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLV-----MTFAGVN 188
            :||.:|.|    .::.||:.:.:.:..:..|......||:.|:..|...:::|     :.|...|
Human    37 VFLFLLFFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKN 101

  Fly   189 DLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAV------- 246
            ..:.:  .|   |.|.:...|...|.....|.|::.|.|:.|.:||.|...::.||.|       
Human   102 KSISF--IG---CATQMLLFVTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASY 161

  Fly   247 ---ITIAAIWLLAAF-VSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSC------ 301
               |..|.|.::|.| :||.               ..|..::..|  |:.|..|:  ||      
Human   162 VAGILHATIHIVATFSLSFC---------------GSNEIRHVFC--DMPPLLAI--SCSDTHTN 207

  Fly   302 --ISFYFP--------CVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKK 356
              :.|||.        .:|:|.....|....:.|                       ..|.:.|.
Human   208 QLLLFYFVGSIEIVTILIVLISCDFILLSILKMH-----------------------SAKGRQKA 249

  Fly   357 FKVRNLH-THSSPYH--------------VSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKT 406
            |.....| |..:.||              .|||      .:|:.:|....:|             
Human   250 FSTCGSHLTGVTIYHGTILVSYMRPSSSYASDH------DIIVSIFYTIVIP------------- 295

  Fly   407 CIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTM 448
                              ..||||||:.|||.:.|.|::|.:
Human   296 ------------------KLNPIIYSLRNKEVKKAVKKMLKL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 37/151 (25%)
7tm_1 145..431 CDD:278431 63/332 (19%)
OR5T3NP_001004747.2 7tm_GPCRs 50..315 CDD:421689 70/348 (20%)
TM helix 2 71..97 CDD:410628 5/25 (20%)
TM helix 3 109..139 CDD:410628 8/29 (28%)
TM helix 4 152..173 CDD:410628 5/20 (25%)
TM helix 5 207..237 CDD:410628 6/29 (21%)
TM helix 6 244..274 CDD:410628 7/29 (24%)
TM helix 7 281..306 CDD:410628 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.