DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Octbeta3R

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster


Alignment Length:346 Identity:107/346 - (30%)
Similarity:167/346 - (48%) Gaps:48/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAGVGSVAATVATSTTSSISSSTTIINTSSATTIGGNHTSGSTGFSTNSTLLDADHLPLQLTTAK 76
            |||..:..|...::|.:|.....|:....|.|......|:.::.....|..:||....|.||...
  Fly    21 AAGAATSQAAATSATNASHLQPATLTGHISTTAAAKTTTTPTSSLPITSQFVDASLTSLSLTATS 85

  Fly    77 VD----------LDIEIDIQLLTNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLSLVSIVVV 131
            .|          |..:...:||:.  .|..:|:..::.:..|.:|:      |...|.|..:::.
  Fly    86 SDASYSSPFSSYLSSDSTFELLST--VGPNITANGSDIAVDNQAEL------EESWLDLSLLLLK 142

  Fly   132 GIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTF-AGVNDLLGYWI 195
            |...|.:|..:|.||.||.:::...|.||.|.|.|:.|||:||:.||...||| |.|....|.|:
  Fly   143 GFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWM 207

  Fly   196 FGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVS 260
            ||...|:.:.:.||..||||||:||.||:|||..|..||.|...:|.:.....:|.:|:|.|.:|
  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272

  Fly   261 FVPISLG------------IHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIG 313
            |.||.||            :| |||             |:..:...||::||.:||:.|.:||:.
  Fly   273 FTPIFLGWYTTEEHLREISLH-PDQ-------------CSFVVNKAYALISSSVSFWIPGIVMLV 323

  Fly   314 IYCRLYCYAQKHVKSIKAVTR 334
            :|.|::   ::.::..||::|
  Fly   324 MYWRIF---KEAIRQRKALSR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 58/132 (44%)
7tm_1 145..431 CDD:278431 76/203 (37%)
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 79/213 (37%)
7tm_1 156..>344 CDD:278431 76/203 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.