DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and DopEcR

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster


Alignment Length:341 Identity:83/341 - (24%)
Similarity:134/341 - (39%) Gaps:67/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVND 189
            |:||:.|.|.||.|:.::...|.         :....:.|.:|.|||||||....||:.|:....
  Fly    21 LISILGVAIVLSNLLIIATYANF---------KGPTEVINYYLLSLAIADLLCGLLVVPFSVYPA 76

  Fly   190 LLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWL 254
            |.|.|::|...|......:|.....|:.....||:|||:.::.||||....|:......:...|:
  Fly    77 LTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTWI 141

  Fly   255 LAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALD------LTPTYAVV---SSCISFYFPCVV 310
            .||.:...|| ||...|     .|:|  ....|.||      .:.|.|::   .|.||       
  Fly   142 SAALLCCPPI-LGYSMP-----IENN--MTHICMLDWGNMAAYSATLAILVLGPSLIS------- 191

  Fly   311 MIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHK 375
            ::..|..::...:|        .|.||....:.|.:.          ...||   |:|.|:... 
  Fly   192 IVHNYGYIFVMMRK--------IRSGEPIHDKEYATA----------LAENL---SNPSHMMSF- 234

  Fly   376 AAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKI-LTWLGYSNSAFNPIIYSIFNKEFR 439
                  .::..|.:.|:|:..:.:........|....... :.|:|..||.:..:|.:..:.:||
  Fly   235 ------ALVFAFWVSWLPWILLRLYEVVTGDVIQSTLINFAVVWIGILNSFWKILIMTSMSPQFR 293

  Fly   440 DAFKRI-LTMRNPWCC 454
            .|.:.. ||:    ||
  Fly   294 IALRVFCLTI----CC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 38/131 (29%)
7tm_1 145..431 CDD:278431 67/295 (23%)
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 76/319 (24%)
TM helix 1 18..42 CDD:410626 8/20 (40%)
TM helix 2 51..73 CDD:410626 12/21 (57%)
TM helix 3 89..111 CDD:410626 3/21 (14%)
TM helix 4 134..150 CDD:410626 3/15 (20%)
TM helix 5 174..197 CDD:410626 5/29 (17%)
TM helix 6 230..252 CDD:410626 4/28 (14%)
TM helix 7 264..289 CDD:410626 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.